Duf5405 family protein

Author: ghup

August undefined, 2024

WebView protein in InterPro IPR035404 DUF5405 Pfam View protein in Pfam PF17399 DUF5405 1 hit MobiDB Search… ProtoNet Search… Sequence Length 100 Mass (Da) 11,356 Last updated 1995-02-01 v1 Checksum 89CBA88D015642CA MFCSRAVVLLNNALKIAVMKNGDLSLIQLGLDKEKREITESVIAIYQSELNLLSDVVNLLVKRAVFHKQISSVDELTKLTTEIASYCADEFKKLNDKRNW … WebSep 29, 2024 · Download alignment. 4F5 protein family. Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine. Although the function …

UniProt

WebTry our new Genome page and use the feedback button to let us know what you think WebOct 9, 2009 · The structure of Thermotoga maritima protein TM841, a protein from the family formerly called DUF194 (renamed DegV; PF02645), has been solved (Schulze … le thalassa marseille

SP076_00070 - DUF5405 domain-containing protein - Salmonella …

WebThis domain family is found in Enterobacteriaceae. This protein may have a phage origin being found in bacteriophage P2. The majority of proteins have a conserved cysteine residue close to their C-terminus which may have functional significance. WebHere we demonstrate that the domain of unknown function 4005 (DUF4005) of the Arabidopsis IQD family protein ABS6/AtIQD16 is a novel MT-binding domain. … WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. … le tian tian

24170245 - Gene ResultPLU_RS14615 DUF5405 family protein []

UniProt

WebDUF99 family protein 1455405 - Gene ResultSSO_RS01265 DUF99 family protein [] Gene provides a unified query environment for genes defined by sequence and/or in … WebA domain of unknown function (DUF) is a protein domain that has no characterised function. These families have been collected together in the Pfam database using the … le thika vannesWebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein ... DUF977 family protein plasmid pBD-50-Km_3 : 32860 73 aa hypothetical protein 32865 M: M.Rte9185ORF7915P (100% identity) M.KmiBD50ORF32865P: 32870 76 aa … le tiki pertuis

"WebLOCUS NC_022750 33628 bp DNA linear PHG 29-JUN-2024 DEFINITION Enterobacteria phage fiAA91-ss, complete genome. ACCESSION NC_022750 VERSION NC_022750.1 DBLINK BioProject: PRJNA485481 KEYWORDS RefSeq. " - Duf5405 family protein

Duf5405 family protein

WebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein 6965 … WebThis domain family is found in Enterobacteriaceae. This protein may have a phage origin being found in bacteriophage P2. The majority of proteins have a conserved cysteine …

Did you know?

WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. … WebThis family of IGBTs was designed for optimum performance in the demanding world of motor control operation as well as other high voltage switching applications. These …

WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules) WebProtein family/group databases. TCDB. 9.A.49.1.3 the prenylated rab acceptor protein 1 (pra1) family; Names & Taxonomy. Protein names. Recommended name. PRA1 family protein 3. Alternative names. ADP-ribosylation factor-like protein 6-interacting protein 5 (ARL-6-interacting protein 5; Aip-5)

WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. DDA3937_RS04160 DUF5405 family protein [] Gene ID: 9732280, updated on 8-Feb-2024. Summary. … WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. PLU_RS14615 DUF5405 family protein [] Gene ID: 24170245, updated on 16-Sep-2024. Summary. …

WebThe present study suggests that SVB and SVBL play a pivotal role in plant growth and trichome development by affecting a specific subset of known trichome developmental …

WebDUF5455 Entrez CDD Structure Protein Help pfam17537: DUF5455 Download alignment Family of unknown function (DUF5455) This is a family of unknown function found in … le tien synonymeWebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. AVT79_gp31 DUF5405 family protein [] Gene ID: 1262456, updated on 12-Oct-2024. Summary. Other designations. DUF5405 family protein ... le tikoun le tikki\u0027s soumansWebNational Library of Medicine 8600 Rockville Pike. Web Policies FOIA. Help Accessibility Careers le tikiaWebThis mouse monoclonal antibody TJ1477 is generated from premade hybridoma library, and specific for Bacillus Phage Shbh1 DUF5405 domain-containing protein. This antibody … le tilly kine marseilleWebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules) le tilia joux hotelsWebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. F846_gp29 DUF5405 family protein [] Gene ID: 14181868, updated on 11-Oct-2024. Summary. Other … le tilak